PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_14061g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 381aa    MW: 42816.8 Da    PI: 6.5792
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_14061g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13.2e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+++++++G+g +W + ++++g++R++k+c++rw++yl
    MA_14061g0010 14 RGPWSPEEDCKLKEYIAKYGTGgNWIALPQKVGLKRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding36.51.1e-1169111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
    MA_14061g0010  69 GGFSEEEDNIISSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.647962IPR017930Myb domain
SuperFamilySSF466891.34E-2611109IPR009057Homeodomain-like
SMARTSM007171.6E-131364IPR001005SANT/Myb domain
PfamPF002491.7E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-231568IPR009057Homeodomain-like
CDDcd001671.94E-101662No hitNo description
PROSITE profilePS5129421.45263117IPR017930Myb domain
SMARTSM007175.9E-1167115IPR001005SANT/Myb domain
PfamPF002492.2E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2269117IPR009057Homeodomain-like
CDDcd001673.56E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MGKAPCCDKA NVKRGPWSPE EDCKLKEYIA KYGTGGNWIA LPQKVGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIS SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKVLLG  120
KRKDHQTRRL AAAKQESHNL QSYATSEAIT NPNIHGPQQA QHVNIDMDAS YSNFGPAIIS  180
QMFEQNYGST IIEFNSRSEA APSQLDPPQI QLDQEVLDHS SCLGELLQRP EGILVDYHSN  240
NNMNMNSTSS PIHASNCINT SQIQQSAVHR QYSTDAASQI FYETSATPVL MYGSHMDNYI  300
KLQQPSAALI ENDNSLFFSA STSPEEGKYK SDWMNTFNVE NNNMGAYEFS MELNDLLLYD  360
SGSQVQQKEH CNYASGSISL Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26141177108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLD5ABB61e-154D5ABB6_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.17e-76myb domain protein 36